General Information

  • ID:  hor005309
  • Uniprot ID:  P30880
  • Protein name:  Calcitonin gene-related peptide (CGRP)
  • Gene name:  CALCA
  • Organism:  Sus scrofa (Pig)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:1990408 calcitonin gene-related peptide receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLSRSGGMVKSNFVPTDVGSEAF
  • Length:  37
  • Propeptide:  SCNTATCVTHRLAGLLSRSGGMVKSNFVPTDVGSEAF
  • Signal peptide:  NA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RAMP1
  • Target Unid:  Q867C0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-P30880-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P30880-F1.pdbhor005309_AF2.pdbhor005309_ESM.pdb

Physical Information

Mass: 445662 Formula: C161H262N48O53S3
Absent amino acids: IQWY Common amino acids: S
pI: 8.24 Basic residues: 4
Polar residues: 17 Hydrophobic residues: 12
Hydrophobicity: 16.22 Boman Index: -4516
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.08
Instability Index: 3560.54 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  3494209
  • Title:  Isolation and amino acid sequence of calcitonin gene related peptide from porcine spinal cord.